PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G171300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 268aa    MW: 30525.4 Da    PI: 9.2914
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G171300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.71.2e-314494151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Brast08G171300.1.p 44 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 94
                        79***********************************************95 PP

2K-box100.22.8e-331122084100
               K-box   4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                         s++   ++e +a+++qqe+akL+ +i nLq+++R l+Ge++ ++s ++L+qLe +L+k+l kiR++Knell+++ie++q++e elq++n +
  Brast08G171300.1.p 112 SNT-GtVAEINAQHYQQESAKLRHQITNLQNSNRTLIGESMATMSQRDLKQLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNDNLY 201
                         333.349999********************************************************************************* PP

               K-box  94 Lrkklee 100
                         Lr+k++e
  Brast08G171300.1.p 202 LRSKVAE 208
                         ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.883696IPR002100Transcription factor, MADS-box
SMARTSM004328.8E-423695IPR002100Transcription factor, MADS-box
CDDcd002652.67E-4437110No hitNo description
SuperFamilySSF554557.59E-3337109IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003892IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-323858IPR002100Transcription factor, MADS-box
PfamPF003191.0E-264592IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-325873IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-327394IPR002100Transcription factor, MADS-box
PfamPF014866.0E-25121206IPR002487Transcription factor, K-box
PROSITE profilePS5129714.214122212IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MQILKEQLAT PSTCLMVKES ESPGSGSGSA GAAEKMGRGR IEIKRIENTT NRQVTFCKRR  60
NGLLKKAYEL SVLCDAEVAL IVFSSRGRLY EYSNNSVKAT IERYKKATSD TSNTGTVAEI  120
NAQHYQQESA KLRHQITNLQ NSNRTLIGES MATMSQRDLK QLEGRLDKGL GKIRARKNEL  180
LCAEIEYMQR REMELQNDNL YLRSKVAENE RGQQQTLNMM GAASTSDQYD QNMIHCDPRN  240
FLQFNIMQQP QYYQQQEDRK AFNSVER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-2036104169Myocyte-specific enhancer factor 2B
1tqe_Q3e-2036104169Myocyte-specific enhancer factor 2B
1tqe_R3e-2036104169Myocyte-specific enhancer factor 2B
1tqe_S3e-2036104169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693130.0KF469313.1 Brachypodium distachyon MADS-box transcription factor 18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288321.11e-177MADS-box transcription factor 58-like
SwissprotQ2V0P11e-148MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLI1HKZ21e-177I1HKZ2_BRADI; MADS-box transcription factor 18
STRINGBRADI2G32910.11e-176(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-100MIKC_MADS family protein